News, Politics, and Culture from 14895

Cuba lake sunset by Debbie Weatherell

The Farmers Market In Wellsville Is Back!

Share:

Located on the front lawn of the David A. Howe Public Library, the Wellsville Village Farmers Market will be operating every Saturday, 9am to 1pm, from the first week in June until the last weekend in September.  Members of the community can browse and purchase fresh fruits, vegetables, home-made goods, and crafts, all from the local area. 

The Wellsville Village Farmers Market is being organized and run by a committee made up of local residents, Stephen Caton, Amanda Silva, and Chris Lukacz.  The committee is holding an informational meeting for all prospective vendors on Wednesday, May 12th at Chelsea’s Catering on Main Street in Wellsville at 6pm.  Local farmers, gardeners, and artisans can learn more about how to get involved as vendors at the market, pick up applications, and learn the various rules and regulations required at this meeting.

In addition to local produce and goods, the Farmers Market has invited area restaurants to showcase some of their most popular, small plate dishes for our patrons.  Each week the market will host a different restaurant so that our friends and families will get a chance to enjoy some delicious light fare while shopping at the market.   

Throughout the summer months, we will be featuring guest speakers who will present information at designated times on local growing tips and techniques, and other interesting topics for the community.  This will include talks, demonstrations, and interactive discussions with local experts their field.

Committee member Stephen Caton says, “The one special thing that makes this Farmers Market a community event is that all fruits and vegetables must be grown within 30 miles of Wellsville in order to be sold here, and all goods and crafts must be produced within that circle as well.”

For more information and applications, view our Facebook page, WellsvilleVillageFM or contact acting Market Manager Stephen Caton at wellsvillevillagefarmersmarket@gmail.com

Previous Article

Full Legislative Agenda Today For Allegany County Legislature

Next Article

Petition Opposing Eminent Domain Filed Against Allegany County Industrial Development Agency(Updated With Full Petition)

You may also like